DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43125 and CG3088

DIOPT Version :9

Sequence 1:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster


Alignment Length:153 Identity:30/153 - (19%)
Similarity:67/153 - (43%) Gaps:38/153 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 GKSSVFSPAPWLVKIRPELSSNITCTGTLINERFVLTAASCIDYQTELIVRLGEIDGTLQNSSKL 92
            |..:....||::|.:... .|||.|:||:|.:.::||:|.|:...:.:.:..|        :::|
  Fly    32 GSPAYEGQAPYVVGMAFG-QSNIWCSGTIIGDTWILTSAQCLTGSSGVTIYFG--------ATRL 87

  Fly    93 QYEEIYVARALIHRSYSSESHQYNIALLRLKTSVVYKKNIQPICIDVNVGKVPKAPTFEIEKKKN 157
            ...:..|.   :..|.....:|: :||:|: ..|.:...:..:.:          |:.       
  Fly    88 SQAQFTVT---VGTSEYVTGNQH-LALVRV-PRVGFSNRVNRVAL----------PSL------- 130

  Fly   158 EEPKKNKAGIMKRFLNWFLSLFG 180
                :|::   :|:.||:.::.|
  Fly   131 ----RNRS---QRYENWWANVCG 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:304450 22/99 (22%)
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 30/153 (20%)
Tryp_SPc 29..244 CDD:214473 30/153 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436116
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.