powered by:
Protein Alignment CG43125 and Jon66Ci
DIOPT Version :9
Sequence 1: | NP_001247344.1 |
Gene: | CG43125 / 12798281 |
FlyBaseID: | FBgn0262588 |
Length: | 258 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_729372.1 |
Gene: | Jon66Ci / 38952 |
FlyBaseID: | FBgn0035886 |
Length: | 260 |
Species: | Drosophila melanogaster |
Alignment Length: | 34 |
Identity: | 13/34 - (38%) |
Similarity: | 19/34 - (55%) |
Gaps: | 2/34 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 36 APWLVKIRPELSSNITCTGTLINERFVLTAASCI 69
||:.|.: ..|....|.|::|:..:||||..||
Fly 48 APYTVGL--GFSGGWWCGGSIISNEWVLTAEHCI 79
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45435786 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR24260 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.030 |
|
Return to query results.
Submit another query.