DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43125 and CG33465

DIOPT Version :9

Sequence 1:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster


Alignment Length:271 Identity:84/271 - (30%)
Similarity:124/271 - (45%) Gaps:42/271 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSATLRLAVFALLLFYQGSALFLEQNC--GKSS--------VFSPAPWLVKIRPELSSNITCTGT 55
            ||..|.||:..|:| .||.|..|::.|  .|:|        ....|||:..|..  ::...|.||
  Fly     1 MSRVLSLALIGLVL-CQGLAQLLDKKCHDPKTSENINFNHGATETAPWMASIYK--NNQFICDGT 62

  Fly    56 LINERFVLTAASCIDYQTELIVRLGEIDGTLQNSSKLQYEEIYVARALIHRSYSSESHQYNIALL 120
            |:::.|||||||||...::|.|..|..:.....|.....|:..||.||.|.::...:...:|.||
  Fly    63 LVHKLFVLTAASCISKDSQLYVLFGMYNQYRDASQFFNNEQYGVAVALQHSNFRPNNGVNDIGLL 127

  Fly   121 RLKTSVVYKKNIQPICIDVNVGKVPKAPTFEIEKKKNEEPKKNKAGIMKRFLNWFLSLFGVREP- 184
            ||...|.:..:|:||||.::  .|.|:..||..:....:.:..:|....| ...:||   .::| 
  Fly   128 RLYGEVTHYAHIRPICIILD--HVVKSAPFERFEGFGWQQQGTEASSQVR-QTVYLS---QKKPF 186

  Fly   185 ---RPDVILP---PQPIA-----------VGWPLTKQINESA--LFHQYGILSHRNSE--SKKDV 228
               |...:||   .|..|           .|.|||.......  :..|.|::|: .||  |...|
  Fly   187 ECHRNGQLLPINEGQFCAGNRDRSFCRSNSGSPLTADFTYGVKNITVQVGLVSY-GSELCSPTSV 250

  Fly   229 YTDVMAYVNWI 239
            ||||:|:.:||
  Fly   251 YTDVVAFKDWI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:304450 35/99 (35%)
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 69/225 (31%)
Tryp_SPc 46..261 CDD:214473 67/223 (30%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463244
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.