DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43125 and sphinx2

DIOPT Version :9

Sequence 1:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster


Alignment Length:240 Identity:42/240 - (17%)
Similarity:79/240 - (32%) Gaps:76/240 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 LVKIRPELSSNITCTGTLINERFVLTAASCIDYQTELIVRLG--------EIDGTLQNSSKLQYE 95
            :|..:..|||.....||:|:.:::||....:.:: .:....|        :|....:.:....|:
  Fly    43 IVYAKSPLSSLKFGAGTIISNQWILTVKEVLIFK-YIEAHFGSKRAFWGYDILRIYRENFYFHYD 106

  Fly    96 EIYVARALIHRSYSSESHQYNIALLRLKTSVV------YKKNIQPICIDVNVGKVPKAPTF---- 150
            :..:. ||:...|    .:::..:.|::....      |..|:..:|......:..:.||:    
  Fly   107 KTRII-ALVKCPY----QKFDRRMSRVRVPAYGARFERYVGNMTMVCGWGTDKRKVRLPTWMRCV 166

  Fly   151 EIEKKKNEEPKKNKAGIMKRFLNWF------LSLFGVRE-----------PRPDVI----LPPQP 194
            |:|...|.|..|....     |.|:      ....||.|           |.|..|    |.|..
  Fly   167 EVEVMNNTECAKYHTP-----LKWYEMCTSGEGFKGVCEGDMGGAVVTMGPNPTFIGIIWLMPTN 226

  Fly   195 IAVGWPLTKQINESALFHQYGILSHRNSESKKDVYTDVMAYVNWI 239
            .::|:|                          .|:..|..::.||
  Fly   227 CSIGYP--------------------------SVHIRVSDHIKWI 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:304450 18/111 (16%)
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 40/238 (17%)
Tryp_SPc 26..248 CDD:304450 42/240 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436380
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.