DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43125 and Jon65Ai

DIOPT Version :9

Sequence 1:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster


Alignment Length:296 Identity:60/296 - (20%)
Similarity:99/296 - (33%) Gaps:105/296 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ATLRLAVFALLLFYQGSALFLEQNCGKSSVFS------PA-----PWLVKIRPELSSNIT-CTGT 55
            |.|.|.|.|....::....:.:...||:|:..      ||     |::|.:....:...| |.|:
  Fly     5 AVLLLGVIASATAFEKPVFWKDVPVGKASIEGRITMGYPAYEGKVPYIVGLGFSKNGGGTWCGGS 69

  Fly    56 LINERFVLTAASCIDYQTELIVRLGEIDGTLQNSSKLQYEEIYVARALIHRSYSSESHQYNIALL 120
            :|...:|:||..|.|....:.:..|.:       .:||.:..:    .:.||...|....:|:|:
  Fly    70 IIGNTWVMTAKHCTDGMESVTIYYGAL-------WRLQAQYTH----WVGRSDFIEHGSGDISLI 123

  Fly   121 RLK----TSVVYKKNIQPI-------------------------------CIDVNVGKVPKAPTF 150
            |..    .|:|.|..:...                               |:||.:|        
  Fly   124 RTPHVDFWSLVNKVELPRYDDRYNNYQGWWALVSGWGKTSDEGGVSEYLNCVDVQIG-------- 180

  Fly   151 EIEKKKNEEPKKNKAGIMKRFLNWFLSLFGVREPRPDVILPPQPI-------AVGWPLTKQINES 208
              |....|              |::.|..|      |:|..|.|.       ..|.||.  |::.
  Fly   181 --ENSVCE--------------NYYGSFSG------DLICIPTPENKGTCSGDSGGPLV--IHDG 221

  Fly   209 ALFHQYGILSHRN-----SESKKDVYTDVMAYVNWI 239
            .  .|.||:|..:     |...|.: ..|.:|::||
  Fly   222 N--RQVGIVSFGSSAGCLSNGPKGM-VRVTSYLDWI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:304450 23/135 (17%)
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 50/262 (19%)
Tryp_SPc 41..257 CDD:238113 52/260 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435621
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.