DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43125 and Jon65Aii

DIOPT Version :10

Sequence 1:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster


Alignment Length:69 Identity:17/69 - (24%)
Similarity:29/69 - (42%) Gaps:13/69 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 PWLVKIRPELSS--NITCTGTLINERFVLTAASCIDYQTELIVRLGEI-----------DGTLQN 88
            |::|.:|.:..:  ...|.|::|...:|||||.|....:.:.:..|.:           .|.|.|
  Fly    49 PYIVALRFDNGNGGGWYCGGSIIGHEWVLTAAHCTYGASYVTISYGAVWRQQPQFTHYDTGNLHN 113

  Fly    89 SSKL 92
            ...|
  Fly   114 DIAL 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:473915 17/69 (25%)
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 17/69 (25%)

Return to query results.
Submit another query.