DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43125 and Jon65Aiii

DIOPT Version :9

Sequence 1:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster


Alignment Length:285 Identity:61/285 - (21%)
Similarity:106/285 - (37%) Gaps:74/285 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LAVFALLLFYQGSALFLEQ------------------NCGKSSVFSPAPWLVKIR-PELSSNITC 52
            |.||||.|....:.|..:|                  ..||::.....|:.|.:. ...|.:..|
  Fly     4 LVVFALALATASAGLLPQQVPIHPRDLPAVTNIEGRITNGKTATSGQFPYQVGLSFASTSGSWWC 68

  Fly    53 TGTLINERFVLTAASCIDYQTELIVRLGEIDGTLQNSSKLQYEEIYVARALIHRSYSSESHQYNI 117
            .|::|:..:|||||.|....:.:.:..|   .|::.|::| .:.:.....:.|.||:|...:.:|
  Fly    69 GGSIIDNTWVLTAAHCTSGASAVTIYYG---ATVRTSAQL-VQTVSADNFVQHASYNSIVLRNDI 129

  Fly   118 ALLRLK----TSVVYKKNIQPI-----------CIDVNVGKVPKAPT----------FEIEKKKN 157
            :|::..    |:::.|..:..|           .|....||...:.|          ||:..   
  Fly   130 SLIKTPTVAFTALINKVELPAIAGTYSTYTGQQAIASGWGKTSDSATSVANTLQYEVFEVVS--- 191

  Fly   158 EEPKKNKAGIMKRFLNWFLSLFGVREPRPDVILPPQPIAV-------GWPLTKQINESALFHQYG 215
                      :.:..|.:.||....    :||....|..|       |.||. .:::|.|.....
  Fly   192 ----------VSQCQNTYGSLVATN----NVICVATPNKVSTCNGDSGGPLV-LVSDSKLIGVTS 241

  Fly   216 ILSHRNSESKKDV-YTDVMAYVNWI 239
            .:|....||.... :|.|.:|::||
  Fly   242 FVSSAGCESGAPAGFTRVTSYLDWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:304450 25/115 (22%)
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 51/248 (21%)
Tryp_SPc 40..269 CDD:238113 53/249 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436248
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.