DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43125 and CG10477

DIOPT Version :9

Sequence 1:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster


Alignment Length:86 Identity:22/86 - (25%)
Similarity:49/86 - (56%) Gaps:5/86 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 CTGTLINERFVLTAASCIDYQTELIVRLGEIDGTLQNSSKLQYEEIYVARALIHRSYSSESHQYN 116
            |.|::|...:|||||.|....:.:.:..|   .|::.|:||: :::..::.:.|..|::.:.:.:
  Fly    68 CGGSIIANTWVLTAAHCTKGASSVTIYYG---STVRTSAKLK-KKVSSSKFVQHAGYNAATLRND 128

  Fly   117 IALLRLKTSVVYKKNIQPICI 137
            |:|:: ..||.:..:|..|.:
  Fly   129 ISLIK-TPSVTFTVSINKIAL 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:304450 22/84 (26%)
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 22/86 (26%)
Tryp_SPc 40..267 CDD:238113 22/86 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436215
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.