DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43125 and CG12133

DIOPT Version :9

Sequence 1:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster


Alignment Length:304 Identity:79/304 - (25%)
Similarity:118/304 - (38%) Gaps:80/304 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VFALLLFYQGSALFLEQNCGKSSVFS-----------PAPWLV---------KIRPELSSNITCT 53
            ||.......|..|...:.||:|...|           ..||.|         |.||    :..|.
  Fly    35 VFTCCPMVAGDKLPDSRVCGQSPPSSYIVGGMEAQSNQFPWTVLLGYEAYTAKQRP----SPMCA 95

  Fly    54 GTLINERFVLTAASCIDYQTELI--VRLGEIDGT-------LQNSSKL---QYEEIYVARALIHR 106
            |:||..|:|||||.|::.....:  |||||.|..       |.|.:|:   .:.:|.|...:.|.
  Fly    96 GSLIASRYVLTAAHCLNVNDFYVARVRLGEHDTENDPDYTWLPNGAKIWAPAHVDIDVDLRVPHE 160

  Fly   107 SYSSES--HQYNIALLRLKTSVVYKKNIQPIC----IDVNVGKVPKAPTFEIEKKKNEEPKKNKA 165
            .|.:.:  |..:|||||||:.|.|...|:|||    |:::.......| |:| ....:...:.|:
  Fly   161 QYYTRNGRHYNDIALLRLKSRVKYTLQIRPICIWPGIELSTSSFKNFP-FQI-AGWGDSGLQQKS 223

  Fly   166 GIMKRFLNWFLSLFGVREPRPDVILPPQP----------IAVGW------------PLTKQINES 208
            .::::.     ::.|:   .||..|...|          .|:||            ||...:...
  Fly   224 TVLRQG-----TISGM---SPDECLNRYPTLLVDKDIQICAMGWDGTDTGLGDSGSPLMASVGRG 280

  Fly   209 A--LFHQYGILSHRNSESK----KDVYTDVMAYVNWITPLALDV 246
            |  .::..||.|:....|.    ..|||...:|..||.....|:
  Fly   281 ADQFYYLAGITSYGGGPSSYGYGPAVYTKTSSYYEWIKKKINDI 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:304450 44/126 (35%)
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 70/271 (26%)
Tryp_SPc 62..317 CDD:214473 68/268 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463605
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.