DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43125 and scaf

DIOPT Version :9

Sequence 1:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster


Alignment Length:202 Identity:49/202 - (24%)
Similarity:82/202 - (40%) Gaps:57/202 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 FSPAPWLVKIRPELSSNITCTGTLINERFVLTAASCID--YQTELIVRLGEID-GTLQNSSKLQY 94
            |:..||...|..|.|..:.|.|.:|.::|||::|||::  ..|::.|:.||.: |:  .:..|.:
  Fly   431 FAEIPWQAMILRESSKTLICGGAIIGDQFVLSSASCVNGLPVTDIRVKAGEWELGS--TNEPLPF 493

  Fly    95 EEIYVARALIHRSYSSESHQYNIALLRLKTSVVYKKNIQPICIDVNVGKVPKAPTFEIEKKKNEE 159
            :...|....:|..|...::.:::|::||:..:.:..:||||||                  .:|:
  Fly   494 QLTGVKTVDVHPDYDPSTNSHDLAIIRLERRLEFASHIQPICI------------------SDED 540

  Fly   160 PKKNKAGIMKRFLNWFLSLFGVREPRPDVILPPQPIAVGWPLTKQI----NESALFHQYGILSHR 220
            ||.::                            |....||  .||.    .|.||.|....|...
  Fly   541 PKDSE----------------------------QCFTSGW--GKQALSIHEEGALMHVTDTLPQA 575

  Fly   221 NSESKKD 227
            .||...|
  Fly   576 RSECSAD 582

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:304450 30/102 (29%)
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 49/202 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435516
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.