DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43125 and CG17572

DIOPT Version :9

Sequence 1:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster


Alignment Length:291 Identity:72/291 - (24%)
Similarity:104/291 - (35%) Gaps:97/291 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LEQN--CGKSSV-------FSPAPWLVKIRPELSSN----ITCTGTLINERFVLTAASC----ID 70
            ||:|  ||||.|       ....|::.:|..:..:.    ..|.|.:|..|.:||||.|    .|
  Fly   118 LEKNQVCGKSLVQGHFYKGLGSYPFVARIGFKHVNTGAFAYPCAGAVIARRVILTAAHCALAKAD 182

  Fly    71 YQTELIVRLGEIDGT----LQNSSKLQYEEI--YVARALIHRSYSSESHQYNIALLRLKTSVVYK 129
            ......||:||.|.:    ..|:.......:  .::..::|..|....:.::||||.|||.:.|.
  Fly   183 GHRLSSVRVGEYDTSSDPDCANTGFCAPRSVNHAISHVIVHPDYKQGQYHHDIALLVLKTPLNYS 247

  Fly   130 KNIQPICIDVNVGKVPKAPTFEIEKKKNEEPKKNKAGIM--KR--FLNW-FLSLFGVREPRP--- 186
            ...||||:                       :|.:|.::  ||  ...| .:|...||:|..   
  Fly   248 VATQPICL-----------------------QKTRANLVVGKRATIAGWGKMSTSSVRQPEMSHL 289

  Fly   187 DVIL-----------------PPQPIAVGW-----------------PLTKQINESALFHQYGIL 217
            ||.|                 .|..|...|                 ||.  |.|:.:|.|.||:
  Fly   290 DVPLTSWDLCLRNYGSTGALESPNSIEGQWMCAGGEGKDVCQGFGGAPLF--IQENGIFSQIGIM 352

  Fly   218 SHRNSESK----KDVYTDVMAYVNWI---TP 241
            |..:....    ..|||.|..:..||   ||
  Fly   353 SFGSDNCGGLRIPSVYTSVAHFSEWIHDNTP 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:304450 31/113 (27%)
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 62/267 (23%)
Tryp_SPc 138..378 CDD:214473 60/264 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.