DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43125 and psh

DIOPT Version :9

Sequence 1:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster


Alignment Length:246 Identity:57/246 - (23%)
Similarity:97/246 - (39%) Gaps:83/246 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 SNITCTGTLINERFVLTAASCI--DYQTELIVRLGEIDGTLQNSSKLQYEEIYVARALIHRSYSS 110
            ::..|.|:||..|||||||.|:  |..|...||||.::  ::|... .|::|.:....||..|  
  Fly   168 TDFRCGGSLIASRFVLTAAHCVNTDANTPAFVRLGAVN--IENPDH-SYQDIVIRSVKIHPQY-- 227

  Fly   111 ESHQYN-IALLRLKTSVVYKKNIQPICIDVNVGKVPKAPTFEIEKKKNEEPKKNKAGIMKRFLNW 174
            ..::|| ||:|.|:..||...||:|.|:..:.               .:.|..:|         :
  Fly   228 VGNKYNDIAILELERDVVETDNIRPACLHTDA---------------TDPPSNSK---------F 268

  Fly   175 FLSLFGV----REPRPDVIL----------------PPQPIAV---------------------- 197
            |::.:||    ...|..::|                ..||.::                      
  Fly   269 FVAGWGVLNVTTRARSKILLRAGLELVPLDQCNISYAEQPGSIRLLKQGVIDSLLCAIDQKLIAD 333

  Fly   198 ------GWPLTKQIN-ESALFHQYGILS--HRNSESKKDVYTDVMAYVNWI 239
                  |.||..::| |..::...|::|  ...:.....:||.|.:|:::|
  Fly   334 ACKGDSGGPLIHELNVEDGMYTIMGVISSGFGCATVTPGLYTRVSSYLDFI 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:304450 35/91 (38%)
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 56/244 (23%)
Tryp_SPc 144..387 CDD:238113 57/246 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437524
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.