Sequence 1: | NP_001247344.1 | Gene: | CG43125 / 12798281 | FlyBaseID: | FBgn0262588 | Length: | 258 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_573297.1 | Gene: | psh / 32832 | FlyBaseID: | FBgn0030926 | Length: | 394 | Species: | Drosophila melanogaster |
Alignment Length: | 246 | Identity: | 57/246 - (23%) |
---|---|---|---|
Similarity: | 97/246 - (39%) | Gaps: | 83/246 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 48 SNITCTGTLINERFVLTAASCI--DYQTELIVRLGEIDGTLQNSSKLQYEEIYVARALIHRSYSS 110
Fly 111 ESHQYN-IALLRLKTSVVYKKNIQPICIDVNVGKVPKAPTFEIEKKKNEEPKKNKAGIMKRFLNW 174
Fly 175 FLSLFGV----REPRPDVIL----------------PPQPIAV---------------------- 197
Fly 198 ------GWPLTKQIN-ESALFHQYGILS--HRNSESKKDVYTDVMAYVNWI 239 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG43125 | NP_001247344.1 | Tryp_SPc | 37..>137 | CDD:304450 | 35/91 (38%) |
psh | NP_573297.1 | CLIP | 30..79 | CDD:197829 | |
Tryp_SPc | 143..384 | CDD:214473 | 56/244 (23%) | ||
Tryp_SPc | 144..387 | CDD:238113 | 57/246 (23%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45437524 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR24260 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.940 |