DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43125 and Hayan

DIOPT Version :9

Sequence 1:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster


Alignment Length:237 Identity:58/237 - (24%)
Similarity:91/237 - (38%) Gaps:62/237 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 SSNITCTGTLINERFVLTAASCI--DYQTELIVRLGEIDGTLQNSSKLQYEEIYVARALIHRSYS 109
            |:...|.|:||..|||||||.|:  |..|...||||.::  ::|... .|::|.|....||..||
  Fly   409 SAAFRCGGSLIASRFVLTAAHCVNSDDSTPSFVRLGALN--IENPEP-GYQDINVIDVQIHPDYS 470

  Fly   110 SESHQYNIALLRLKTSVVYKKNIQPICIDVNVGKVPK---------------------------- 146
            ..|..|:||:|:|.........|:|.|:..:....|.                            
  Fly   471 GSSKYYDIAILQLAEDAKESDVIRPACLYTDRSDPPANYKYFVAGWGVMNVTNRAVSKILLRAAL 535

  Fly   147 --APTFEIEKKKNEEPKKNKAGIMKRFLNWFLSLFGV---------REPRPDVILPPQPIAVGWP 200
              .|..|......|:|..|:.  ::|         ||         :..|.|......    |.|
  Fly   536 DLVPADECNASFAEQPSANRT--LRR---------GVIASQLCAADKNQRKDACQGDS----GGP 585

  Fly   201 LTKQINE-SALFHQYGILSHRNSESKK--DVYTDVMAYVNWI 239
            |..:|:: ...:...|::|.....:.|  .:||.|.:::::|
  Fly   586 LILEIDDVDGTYSIVGVISSGFGCATKTPGLYTRVSSFLDYI 627

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:304450 35/91 (38%)
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 57/235 (24%)
Tryp_SPc 385..630 CDD:238113 58/237 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437525
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.