DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43125 and CG31220

DIOPT Version :9

Sequence 1:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_732440.2 Gene:CG31220 / 326126 FlyBaseID:FBgn0051220 Length:363 Species:Drosophila melanogaster


Alignment Length:148 Identity:42/148 - (28%)
Similarity:61/148 - (41%) Gaps:40/148 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 NCGKSSV-----------FSPAPWLVKI--------RPELSSNITCTGTLINERFVLTAASCIDY 71
            :|||...           .:..|||..:        .|:.....:|.|:|||.|:|||||.|:  
  Fly    94 DCGKPQTTNRVIGGTEPNLNEYPWLAMLLYRNRSAFNPDRELVPSCGGSLINTRYVLTAAHCV-- 156

  Fly    72 QTELI-----VRLGEIDGTLQNSSKLQ----------YEEIYVARALIHRSYSSESHQY--NIAL 119
             |:.:     ||||| ..|..|...:.          :.:|.|.....|..|...::.:  :|||
  Fly   157 -TDTVLQIQRVRLGE-HTTSHNPDCISRGARIVCAPTHLDIDVESITSHNDYDPANYTFRNDIAL 219

  Fly   120 LRLKTSVVYKKNIQPICI 137
            :|||..|.|.....|||:
  Fly   220 VRLKEPVRYTMAYYPICV 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:304450 38/124 (31%)
CG31220NP_732440.2 Tryp_SPc 103..357 CDD:214473 39/139 (28%)
Tryp_SPc 104..360 CDD:238113 39/138 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463613
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.