DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43125 and CG31269

DIOPT Version :9

Sequence 1:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster


Alignment Length:297 Identity:67/297 - (22%)
Similarity:107/297 - (36%) Gaps:96/297 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSATLRLAVFALLLFYQGSALFLEQNC-------------GKSSVFSPAPWLVKIRPELSSNITC 52
            |||.:.|.:..|......:|:.::.|.             |:::....||:.:.:: .:|...:|
  Fly     1 MSAVVLLILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQ-GISGAHSC 64

  Fly    53 TGTLINERFVLTAASCIDYQTELIVRLGEIDGTLQNSSKLQYEEIYVARAL-IHRSYSSESHQYN 116
            .|.:|||.||||||.|:  :...|..|..:.||.:.:   |....|..:|: ||.:|.:.....:
  Fly    65 GGAIINETFVLTAAHCV--ENAFIPWLVVVTGTNKYN---QPGGRYFLKAIHIHCNYDNPEMHND 124

  Fly   117 IALLRLKTSVVYKKNIQPICIDVNVGKVPKAPTFEIEKKKNEEPKKNKAGIMKRFLNWFLSLFGV 181
            ||||.|...:.:.:..|||       .:|..|                                 
  Fly   125 IALLELVEPIAWDERTQPI-------PLPLVP--------------------------------- 149

  Fly   182 REPRPDVILPPQPIAVGWPLTKQINESALFHQYGILSHRNSES--KKDVYTDV------------ 232
            .:|..:|||......|.|. |..|:...|:.||  :.||..::  ..|...||            
  Fly   150 MQPGDEVILTGWGSTVLWG-TSPIDLQVLYLQY--VPHRECKALLSNDEDCDVGHICTFSRLGEG 211

  Fly   233 ----------------MAYVNWITPLAL---DVHITM 250
                            :..|||..|.|.   |||.::
  Fly   212 ACHGDSGGPLVSNGYLVGLVNWGWPCATGVPDVHASV 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:304450 32/100 (32%)
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 60/261 (23%)
Tryp_SPc 38..258 CDD:238113 60/260 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.