DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43125 and CG31205

DIOPT Version :9

Sequence 1:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster


Alignment Length:280 Identity:60/280 - (21%)
Similarity:105/280 - (37%) Gaps:95/280 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 QGSALFLEQNCGKSSVFSPA---PWLVKI---RPELSSNITCTGTLINERFVLTAASCIDY-QTE 74
            |...:|.|:.....::.:..   ||:|:|   ..:.|:.:.|||.||:.|.|:|||.|:.. ::|
  Fly    27 QECGIFNEKQYNSDNIIAEPTEHPWVVRIVGVTKDGSNTLLCTGILIDSRRVVTAAHCVSKDESE 91

  Fly    75 LI--VRLGEIDGTLQNSSKLQYEEIYVARALIHRSYSSESHQYNIALLRLKTSVVYKKNIQPICI 137
            .|  |..|:.|.:..|         .|:...:|..||....:.::|::.|...||:...:||||:
  Fly    92 SIYGVVFGDSDSSNIN---------LVSAVTVHPDYSPRKFENDLAIIELTKEVVFSDLVQPICL 147

  Fly   138 DVNVGKVP--------------KAPTFE-------------------IEKKKNEE-----PKKNK 164
            ......||              :.|:|:                   |:.|:..|     |::..
  Fly   148 PSVSEMVPGSETSNSKLIVAGLEGPSFDRRHSATQRLDKRIKMTYTKIDSKECHEKQARFPEELI 212

  Fly   165 AGIMKRFLNWFLSLFGVREPRPDVILPPQPIAVGWPLTKQINESALFHQYGI---------LSHR 220
            .|..:|                      .|:: |..||:.......||..||         |.|:
  Fly   213 CGHTER----------------------SPLS-GSALTEASGTPRQFHLLGIAVAGFFSSDLDHQ 254

  Fly   221 NSESKKDVYTDVMAYVNWIT 240
            .       |.::..:::||:
  Fly   255 G-------YLNIRPHLDWIS 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:304450 33/105 (31%)
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 36/132 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.