DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43125 and spirit

DIOPT Version :9

Sequence 1:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster


Alignment Length:247 Identity:66/247 - (26%)
Similarity:101/247 - (40%) Gaps:62/247 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 CTGTLINERFVLTAASCIDYQTE--LIVRLGEIDGTLQNSSKLQYEEIYVARALIHRSYSSESHQ 114
            |.|.||...||||||.|.|...|  ..||||..:.||...     |:|.:.|.:||..||:.:..
  Fly   163 CGGALIANNFVLTAAHCADLGGEPPSQVRLGGDNLTLTEG-----EDISIRRVIIHPDYSASTAY 222

  Fly   115 YNIALLRLKTSVVYKKNIQPICI----------------------DVNVGKVPKAPTFEIEKKKN 157
            .:||||.|:|:.  |..::|.||                      .::..::.|.|   ::...|
  Fly   223 NDIALLELETAA--KPELKPTCIWTQKEVTNTLVTAIGYGQTSFAGLSSAQLLKVP---LKSVSN 282

  Fly   158 EEPKKN--KAGIMKRFLNWFL---SLFGVREP-RPDVILPPQPIAVGWPLTKQINESALFHQYGI 216
            ||.:.:  |..:.:..|...:   .:.|.|:. :.|         .|.||..|  :..|.:..||
  Fly   283 EECQHHYQKDQLAQGVLGTQMCAGDITGERDTCQGD---------SGGPLLMQ--DGLLGYVVGI 336

  Fly   217 --LSHRNSESKKDVYTDVMAYVNWITPLALDV-HITMAP--------NTDFD 257
              |....:.....|||.|.::|:||..:.... .:|.||        :.:||
  Fly   337 TSLGQGCASGPPSVYTRVSSFVDWIEGIVWPAQQVTNAPQPNQMTSFSPEFD 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:304450 34/86 (40%)
spiritNP_001162707.1 CLIP 51..98 CDD:197829
Tryp_SPc 132..364 CDD:238113 61/221 (28%)
Tryp_SPc 132..361 CDD:214473 59/218 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437522
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.