DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43125 and CG18636

DIOPT Version :9

Sequence 1:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster


Alignment Length:279 Identity:75/279 - (26%)
Similarity:113/279 - (40%) Gaps:61/279 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LAVFALLLFYQGSALFLEQNC--------------GKSSVFSPAPWLVKIRPELSSNITCTGTLI 57
            :.:|.||  :.|.:.||:..|              |.::.::.:||:|.:. ..:....|.|:||
  Fly    15 ILMFQLL--HSGCSQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLH-STTDMFVCGGSLI 76

  Fly    58 NERFVLTAASCIDYQTELIVRLGEIDGTLQNSSKLQY----EEIYVARALIHRSYSSESHQYNIA 118
            .::.|||||.|......|:.||||.:.|........|    ||..|.....|:.|...:|..:||
  Fly    77 TDKLVLTAAHCFIANQHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIA 141

  Fly   119 LLRLKTSVVYKKNIQPICIDVN------VGKVPKAPTFEIEKKKNEEPKKNKAGIMKRFLNWFLS 177
            :|||..||||:.||:|||:..:      :.|:.........|.:.|....            .|.
  Fly   142 ILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGKTQMESDSD------------ALQ 194

  Fly   178 LFGVREPRPDV--------ILPPQPIAVGW-----------PLTKQI--NESALFHQYGILSHRN 221
            ...:|...|||        |...|..|..|           ||...|  ..:..|.|.||.|:.|
  Fly   195 TLDIRRQPPDVCAKFIGQTIAGNQFCAGNWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTN 259

  Fly   222 SESKK-DVYTDVMAYVNWI 239
            ...:| .|:|||:::..:|
  Fly   260 RNCQKASVFTDVLSHAEFI 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:304450 39/103 (38%)
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 67/246 (27%)
Tryp_SPc 45..278 CDD:238113 67/245 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463388
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.