DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43125 and CG33462

DIOPT Version :9

Sequence 1:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster


Alignment Length:298 Identity:73/298 - (24%)
Similarity:112/298 - (37%) Gaps:90/298 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 QGSALFLEQNCG------KSSV---FSPAPWLVKIRPELSSNITCTGTLINERFVLTAASCIDYQ 72
            ||..:.||::||      :.||   .:..||:..:  |......|:|||||..||||||.|:...
  Fly    19 QGFQMLLEEDCGIPHNISERSVNAKLAQNPWMAYL--ETPKGFHCSGTLINHLFVLTAAHCVPDD 81

  Fly    73 TELIVRLGEIDGTLQNSSKLQ---------YEEIYVARALIHRSYSSESHQYNIALLRLKTSVVY 128
            ..:.|||||.:    ..:|:.         ::|..|.....||.|::.....:|.:|||...|.|
  Fly    82 LLITVRLGEYN----TKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEY 142

  Fly   129 KKNIQPICIDVNVGKVPKAPTFEIEKKKNEEPKKNKAGIMKRFLNWFLSLFGVREPRPDVI---- 189
            ..:|:||||              ....:.:||...        |.||.:... ||...:..    
  Fly   143 LNHIRPICI--------------FASNRFQEPIDQ--------LTWFTTTVW-RETAANATSKVL 184

  Fly   190 ----LPPQPIAV-----GWPLT-KQI------------------------NESALFHQYGILSHR 220
                :..||...     ||.:| :||                        |.|..:.|.||.|..
  Fly   185 RTMNIDRQPKETCSEIYGWNMTFEQICAGNTLSQLCSTDSGAPQIRKMWHNGSDRYVQLGIASRV 249

  Fly   221 NSESKKD-VYTDVMAYVNWITPLALDVHITMAPNTDFD 257
            ..:.:.. :..|:::|.:||..:...    ..|:||.:
  Fly   250 KGQCQNSGILMDLLSYADWIKRVVRQ----YGPSTDMN 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:304450 36/108 (33%)
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 62/252 (25%)
Tryp_SPc 48..269 CDD:214473 60/249 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463367
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.