DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43125 and Sp212

DIOPT Version :10

Sequence 1:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster


Alignment Length:128 Identity:36/128 - (28%)
Similarity:59/128 - (46%) Gaps:19/128 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 CGKSSVFSP------------APWLVKI--RPELSSNITCTGTLINERFVLTAASCIDYQTE--L 75
            ||:....:|            .|||..:  :...:....|.|:||:...|::||.|:...||  :
  Fly   267 CGREGSTTPFIVRGNEFPRGQYPWLSAVYHKEVRALAFKCRGSLISSSIVISAAHCVHRMTEDRV 331

  Fly    76 IVRLGEIDGTLQNSSKLQYEEIYVARALIHRSYSSESH-QYNIALLRLKTSVVYKKNIQPICI 137
            :|.||..|  |.:..:...|...|.|.|.|..|::.|: ..:|||:.::..|.:...|.|||:
  Fly   332 VVGLGRYD--LDDYGEDGAEMRNVMRLLWHPDYNTRSYSDADIALITIERPVTFNDIIAPICM 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:473915 32/104 (31%)
Sp212NP_996209.2 GD_N 23..127 CDD:464985
Tryp_SPc 277..514 CDD:238113 33/118 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.