DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43125 and CG30187

DIOPT Version :9

Sequence 1:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001246475.2 Gene:CG30187 / 246509 FlyBaseID:FBgn0050187 Length:500 Species:Drosophila melanogaster


Alignment Length:269 Identity:72/269 - (26%)
Similarity:119/269 - (44%) Gaps:47/269 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RLAVFALLLFY---QGSALFLEQNC----------GKSSVFSPAPWLVKIRPELSSNITCTGTLI 57
            |||...::.::   .|:::||:|.|          |.::.|..:.|:..:...  ::..|.||||
  Fly     4 RLAWIPVIFWFLKDVGASIFLDQICGINIALKITGGHNAAFQNSVWMAAVHNR--THFICGGTLI 66

  Fly    58 NERFVLTAASCIDYQTELIVRLGEIDGTLQNSSKLQYEEIYVARALIHRSYS-SESHQYNIALLR 121
            ::|||||||.||..|....|.|    |....|.....::  |..|::|.|:. ..|::.:|.||:
  Fly    67 HKRFVLTAAHCIVDQDVQSVSL----GAYNKSDPADRKD--VITAVVHSSFDVRASYENDIGLLK 125

  Fly   122 LKTSVVYKKNIQPICIDVN---VGKVPKAPTFEIEKKKNEEPKKNKAGIMKRFLNWF-------- 175
            |.:.|::...|:||||.:|   ...:....||:..........|....:....||..        
  Fly   126 LSSDVIFNALIRPICIVLNKSMANHMRNMRTFKAFGWGTLRGNKTSDILQTIILNHLDREECYME 190

  Fly   176 LSLFGVREPRPDVILPPQPIA------VGWPLTKQINESALFH---QYGILS-HRNSESKKDVYT 230
            ||::    |....|....|..      .|.|||..:....:.:   |:||:| .:.|...:.|||
  Fly   191 LSVY----PSEKQICAGVPSGDTCGGDSGGPLTNDVFIQGIGNREVQFGIISVGKTSCDGQGVYT 251

  Fly   231 DVMAYVNWI 239
            |:|::.:||
  Fly   252 DLMSFADWI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:304450 33/100 (33%)
CG30187NP_001246475.2 Tryp_SPc 35..260 CDD:214473 62/236 (26%)
Trypsin 316..>384 CDD:355628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.