DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43125 and CG30098

DIOPT Version :9

Sequence 1:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster


Alignment Length:287 Identity:67/287 - (23%)
Similarity:113/287 - (39%) Gaps:80/287 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSATLRLAVFALLLFY--QGSALFLEQNC----------GKSSVFSPAPWLVKIRPELSSNITCT 53
            |:..:.|..|.::|..  .|.:..|:..|          |:::  ...||:..:..:  :...|.
  Fly     1 MTPAIVLLTFLVILTLGSYGYSQLLDSKCIALFRIRVIGGQNA--RRTPWMAYLIRD--NRFACG 61

  Fly    54 GTLINERFVLTAASCIDYQTELIVRLGEIDGTLQNSSKLQ-YEEIYVARALIHRSYSSESHQYNI 117
            |:||..|||||||.|......|.|||||.|.:.....:.: |..:.:.|   |::| .:...::|
  Fly    62 GSLIAYRFVLTAAHCTKINDNLFVRLGEYDSSRTTDGQTRSYRVVSIYR---HKNY-IDFRNHDI 122

  Fly   118 ALLRLKTSVVYKKNIQPICIDVNVGKVPKAPTFEIEKKKNEEPKKNKAGIMKRFLNWFLSLFG-- 180
            |:|:|...|||...|:||||.:|.|....|.:.:                     |:.|:.:|  
  Fly   123 AVLKLDRQVVYDAYIRPICILLNSGLQSLANSIQ---------------------NFTLTGWGQM 166

  Fly   181 --------------VREPRPDVILPP-------QPIAV------GWPLTKQI--NESALFHQYGI 216
                          :|..|.:....|       .|:..      |.||...:  ....::.|:|:
  Fly   167 AHYYKMPTTLQEMSLRRVRNEYCGVPSLSICCWNPVQYACFGDSGGPLGSLVKYGHKTIYVQFGV 231

  Fly   217 LSHRNSESKK----DVYTDVMAYVNWI 239
               .||.:..    ..|.|:|:|:.|:
  Fly   232 ---TNSVTGNCDGYSSYLDLMSYMPWL 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:304450 35/100 (35%)
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 59/249 (24%)
Tryp_SPc 37..258 CDD:238113 60/251 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463249
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.