DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43125 and CG30091

DIOPT Version :9

Sequence 1:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster


Alignment Length:320 Identity:72/320 - (22%)
Similarity:123/320 - (38%) Gaps:121/320 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LAVFA-LLLFYQGSALFLEQNCGKSSVFSPA------------PWLVKIRPELSSNITCTGTLIN 58
            :.:|| :|...:|||..|:::||......|.            ||:..|:  .:....|.|::|.
  Fly     6 VVLFAWMLTAGRGSARLLDEDCGVPMQLIPKIVGGVDAGELKNPWMALIK--TNDEFICGGSVIT 68

  Fly    59 ERFVLTAASCIDYQTELIVRLGEIDGT------LQNSSKLQYEEIY-VARALIHRSYSSESHQYN 116
            .:||||||.|:....|.||:..::..|      |.........||| |.|..||.|::.::::.:
  Fly    69 NKFVLTAAHCMCTDEECIVKYTQLTVTLGVYHLLATGEHNHPHEIYNVERVYIHDSFAIQNYRND 133

  Fly   117 IALLRLKTSVVYKKNIQPICIDVNVGKVPKAPTFEIEKKKNEEPKKNKAGIMKRFLNWFLSLFGV 181
            ||||||:.|:|||..|:|:||.:|                  :..|.:..:::.|          
  Fly   134 IALLRLQKSIVYKPQIKPLCILLN------------------DQLKPQTDLIQEF---------- 170

  Fly   182 REPRPDVILPPQPIAVGWPLT------------------KQINESALFH---------------- 212
                         .|:||.:|                  :::.|:|.::                
  Fly   171 -------------TAIGWGVTGNGKMSNNLQMVKIYRIDRKMCEAAFWYTFDYPMFCAGTAVGRD 222

  Fly   213 -----------------------QYGILSHRNSESKK-DVYTDVMAYVNWITPLALDVHI 248
                                   |.||:|....:.:. .:|||||.::::|..:.||..|
  Fly   223 TCKRDSGGPLYIHMLFDGIKRATQLGIVSTGTEDCRGFGMYTDVMGHIDFIERIVLDADI 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:304450 38/106 (36%)
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 58/279 (21%)
Tryp_SPc 37..276 CDD:238113 59/281 (21%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463409
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.