DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43125 and CG30083

DIOPT Version :9

Sequence 1:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster


Alignment Length:281 Identity:78/281 - (27%)
Similarity:127/281 - (45%) Gaps:56/281 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VFALLLFYQGS-ALFLEQNCGKSSVFSPA------------PWLV---KIRPELSSNITCTGTLI 57
            :|.::|.:.|: :.|||.|||...: ||.            ||:.   |...:..:.:.|.||||
  Fly     6 IFKIILLWPGAMSQFLEPNCGYPDI-SPKIMHGQNAENGTNPWMAYIFKYNDKEVAELVCGGTLI 69

  Fly    58 NERFVLTAASCIDYQTELIVRLGEIDGTLQNSSKLQYEEIYVARALIHRSYSSESHQYNIALLRL 122
            :::|||:||.||.....|.|||||     .:||:.    ..|.:|..::.:::.|:..:|.:||:
  Fly    70 HKQFVLSAAHCIKRDQILAVRLGE-----HSSSRY----FAVTKAFRNKYFTTGSYSNDIGILRI 125

  Fly   123 KTSVVYKKNIQPICIDVNVGKVPKAPTFEIE---KKKNEEPKKNKAGIMKRFLN--------WFL 176
            :..|.:...|:||||..:..|||...||:..   |.:||...|....:....||        |  
  Fly   126 QPIVKFNAVIRPICIITDPTKVPNVKTFKAAGWGKTENETFSKVLKTVELNELNASECYNMLW-- 188

  Fly   177 SLFGVRE-------PRPDVILPPQPIAVGWPLTKQI--NESALFHQYGILSHRNSE-SKKDVYTD 231
              ..|.|       |..|......    |.||...:  :.|..:.|.||:|..:|. :...|||.
  Fly   189 --VNVTESQICAGHPDGDTCAGDS----GGPLIHPVYMDGSLRYVQLGIISFGSSLCNSPGVYTR 247

  Fly   232 VMAYVNWITPLALDVHITMAP 252
            :.::::||. :.:|.:...:|
  Fly   248 LSSFIDWIL-MVVDNYTVRSP 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:304450 33/102 (32%)
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 63/238 (26%)
Tryp_SPc 34..255 CDD:238113 63/237 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463402
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.