DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43125 and CG30082

DIOPT Version :9

Sequence 1:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster


Alignment Length:286 Identity:87/286 - (30%)
Similarity:128/286 - (44%) Gaps:67/286 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TLRLAVFALL--LFYQGSALFLEQNCGKSSVFSPA--------------PWLVKIRPELSSNITC 52
            :|.:|.||.|  |..:..|.|::.|||.:....|.              |||..:..  :|::.|
  Fly     3 SLWIASFAFLVCLTPKLRAQFIDPNCGTTINLPPTNRIVGGRTADIGSNPWLAYLHK--NSSLVC 65

  Fly    53 TGTLINERFVLTAASCIDYQTELIVRLGEIDGTLQNSSKLQ---------YEEIYVARALIHRSY 108
            |||||.:|||||||.|:.....|.|||||.|    .|:::.         |||..|..|.||..:
  Fly    66 TGTLITKRFVLTAAHCLHSFHLLTVRLGEYD----TSTRIDCTSEFCIPTYEEYSVENAYIHTFF 126

  Fly   109 SSESHQYN-IALLRLKTSVVYKKNIQPICIDVNVGKVPKAPTFE------IEKKKNEEPKKNKAG 166
            .......| |.||:|..:||||..|:|||:..:.|:||.:.|:|      |:       ..|.|.
  Fly   127 GGRQDSRNDIGLLKLNGTVVYKLFIRPICLFRDPGQVPYSSTYEAAGWGKID-------LINTAT 184

  Fly   167 IM-------------KRFLNWFLSL--FGVREPRPDVILPPQPIAVGWPLTKQINESALFH--QY 214
            ::             :|.|...||.  |...:.|.|......    |.||:::::...:..  |.
  Fly   185 VLQTVNLIRLDQSDCERSLRTSLSYGQFCAGQWRADTCSGDS----GGPLSRKMSNGRITRTVQL 245

  Fly   215 GILSHRNSESK-KDVYTDVMAYVNWI 239
            ||:|:.:...: ..|||.|.::.|||
  Fly   246 GIVSYGHYLCRGPGVYTYVPSFTNWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:304450 45/109 (41%)
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 73/248 (29%)
Tryp_SPc 40..274 CDD:238113 75/249 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463360
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.