DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43125 and T22A3.6

DIOPT Version :9

Sequence 1:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_492773.3 Gene:T22A3.6 / 188711 WormBaseID:WBGene00011909 Length:491 Species:Caenorhabditis elegans


Alignment Length:195 Identity:45/195 - (23%)
Similarity:60/195 - (30%) Gaps:81/195 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 APWLVKIRP--ELSSNITCTGTLINERFVLTAASCIDYQTELIVRLGEIDGTLQNSSKLQYEEIY 98
            ||.....||  |.||:..|   |..:.|..|     ||....|:.|.::.|..::.. |.||..:
 Worm   166 APCFQPCRPSTETSSDFVC---LNRDGFPYT-----DYDMSDILDLPQLIGIFKDVD-LMYESRF 221

  Fly    99 VARALIHRSYSSESHQYNIALLRLKTSVVYKKNIQPICIDVNVGKVPKAPTFEIEKKKNEEPKKN 163
            |..:|..            .:.||.|.         .||                         |
 Worm   222 VLPSLPD------------GVQRLSTK---------SCI-------------------------N 240

  Fly   164 KAGIMKRFLNW----------FLSLFGVREPRPDVILPPQPIAVGWPLTKQINESALF-HQYGIL 217
            |..|...|..|          ||:..|.|:.| |:..|            ..||..:| :|.|||
 Worm   241 KGHIANHFGPWIAVLDQTATQFLAAAGRRKLR-DLCFP------------SFNEHEIFTYQQGIL 292

  Fly   218  217
             Worm   293  292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:304450 23/101 (23%)
T22A3.6NP_492773.3 KR 98..173 CDD:350900 2/6 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.