DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43125 and CG43742

DIOPT Version :9

Sequence 1:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001261130.1 Gene:CG43742 / 14462622 FlyBaseID:FBgn0263999 Length:474 Species:Drosophila melanogaster


Alignment Length:286 Identity:72/286 - (25%)
Similarity:117/286 - (40%) Gaps:68/286 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSATLRLAVFALLLFYQGSALFLEQNCGKSSVFSPAPWLVKIRPEL------SSNITCTGTLINE 59
            |.....|.:.|::::....|..|::||.....:..|.....|..:.      :|...|.|:||::
  Fly     1 MCCWFSLLLVAVVIYQNAFAQLLDENCKVKITYRVANGHTAITSQFMAALYNNSEFFCGGSLIHK 65

  Fly    60 RFVLTAASCIDYQTELIVRLGEIDGTLQNSS----------KLQYEEIYVARALIHRSYSSESHQ 114
            ::|||||.|:....|:.|.|||     .|.|          :|.      |:.::|.::......
  Fly    66 QYVLTAAHCVRDLDEVTVHLGE-----NNRSCPIPVCKHVLRLN------AKVILHPNFHGNIFL 119

  Fly   115 YNIALLRLKTSVVYKKNIQPICIDVNVGKVPKAPTFEIEKKKNEEP------KKNKAGIMKRFLN 173
            .:||||||:..|:::.:|:||||.::          |.....|:..      .|.:.|.:...|:
  Fly   120 NDIALLRLEREVIFEAHIRPICIILD----------EDVTSNNQNNFTAYGWGKTEHGNISDVLS 174

  Fly   174 WFLSLFGVREPRPDVILPPQPIAV------------GWPLTKQI-----NESALFHQYGILSHRN 221
             |:.|  ||.|:.........|..            |.||....     :...||   ||.|:.:
  Fly   175 -FIDL--VRLPKSMCYQNINTICAGSTSGDTCESDSGGPLIGNFVHRGKSRDILF---GITSYGD 233

  Fly   222 SESKK--DVYTDVMAYVNWITPLALD 245
            :|...  .|||||.||.:||..:.|:
  Fly   234 AECSGLFGVYTDVNAYKSWIASVVLE 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:304450 32/115 (28%)
CG43742NP_001261130.1 Tryp_SPc 34..253 CDD:214473 62/245 (25%)
Tryp_SPc 35..256 CDD:238113 64/247 (26%)
Tryp_SPc 273..467 CDD:214473
Tryp_SPc 273..>368 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463243
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.