DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43125 and CG43110

DIOPT Version :9

Sequence 1:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster


Alignment Length:263 Identity:79/263 - (30%)
Similarity:121/263 - (46%) Gaps:72/263 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ALFLEQNCGKSSVFSPAPWLVKIRPELSSN-----------------ITCTGTLINERFVLTAAS 67
            ::||:|.|||    :|.|.::.     .||                 :.|.||:|:|.||||.|.
  Fly    21 SMFLKQPCGK----TPVPKIIS-----GSNASQQSAQYMAGIFNTTHLLCGGTIIHEDFVLTVAH 76

  Fly    68 CIDYQTELIVRLGEIDGTLQNSSKLQYEEIYVARALIHRSYSSESHQYNIALLRLKTSVVYKKNI 132
            |...|| |.||||..:  :.:.:    ::|.|...:.|..||:.::..:|||::|:.||::..||
  Fly    77 CKSTQT-LFVRLGAYN--INHPT----DQIRVIETIAHPQYSNSTYANDIALVKLERSVIFNLNI 134

  Fly   133 QPICI--DVNVGK-VPKAPTFEIEKKKNEEPKKNKAGIMKR-FLN--------WFLSLFGVREPR 185
            |||||  |..:|| :.....|...:.:|.|    ::.|::| |:|        .:|.:      .
  Fly   135 QPICIHLDATLGKQIRYYNAFGWGRTRNAE----QSDILQRIFVNRTNPMICHLYLGM------S 189

  Fly   186 PDVILPPQPIAV-----------GWPLTKQIN-ESALFH-QYGILSHRNSE-SKKDVYTDVMAYV 236
            ||   |.|..|.           |.||..:|. :...|. |:||.|:...| :...:||||..|.
  Fly   190 PD---PKQICATTDQGDTCAGDSGGPLISKITYQGKNFDTQFGITSYGTRECNGVGLYTDVSQYS 251

  Fly   237 NWI 239
            .||
  Fly   252 GWI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:304450 37/116 (32%)
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 69/243 (28%)
Tryp_SPc 36..257 CDD:238113 71/244 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463241
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.