DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43125 and CG43124

DIOPT Version :9

Sequence 1:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001247345.1 Gene:CG43124 / 12798282 FlyBaseID:FBgn0262587 Length:245 Species:Drosophila melanogaster


Alignment Length:260 Identity:86/260 - (33%)
Similarity:138/260 - (53%) Gaps:34/260 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSATLRLAVFALLLFYQGSALFLEQNC----GKSSVFSPAPWLVKIRPELSSNITCTGTLINERF 61
            |:....:.:..:|:||||||..||::|    .:.:..|.||||.:|..:  |.:.|.|.|||..:
  Fly     1 MNTARWIVLCIVLMFYQGSAQTLEEDCVDHMERINGSSYAPWLAEILSD--SKVICAGALINNLY 63

  Fly    62 VLTAASCIDYQTELIVRLGEIDGTLQNSSKLQYEEIYVARALIHRSYSSESHQYNIALLRLKTSV 126
            |||||||.....:|.||||  .|....|    ||...|.:|....::...::..|:.:.||:|.|
  Fly    64 VLTAASCFKENEKLTVRLG--SGYFDKS----YENFRVTKAYFWMTHFPANNTNNLCIFRLQTEV 122

  Fly   127 VYKKNIQPICIDVNVGKVPKAPTFEIEKKKNEEPK-----KNKAGIMKRFLNWFLSLFGVREPRP 186
            .:|.:|:|:||..:...:..|.||||   .||:||     ||..|:..::      :||..|.: 
  Fly   123 EFKTHIRPMCITKSPKSLGLATTFEI---INEKPKMWYFCKNIKGLFCKY------VFGENEEK- 177

  Fly   187 DVILPPQPIAVGWPLTKQINESAL--FHQYGILSHRNSESKKDVYTDVMAYVNWITPLALDVHIT 249
                 .|....|.|.|:.|:....  ..:|||||:|::::..:||.:||:::|||..::|::.|:
  Fly   178 -----WQSKPTGSPWTETISNGPFKGLVRYGILSYRDNKTYDEVYINVMSHINWIAQISLEIDIS 237

  Fly   250  249
              Fly   238  237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:304450 36/99 (36%)
CG43124NP_001247345.1 Tryp_SPc 41..>133 CDD:304450 36/99 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.