DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43125 and CG42694

DIOPT Version :9

Sequence 1:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001188994.1 Gene:CG42694 / 10178792 FlyBaseID:FBgn0261584 Length:512 Species:Drosophila melanogaster


Alignment Length:272 Identity:70/272 - (25%)
Similarity:117/272 - (43%) Gaps:63/272 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VFALLLFY-----QGSALFLEQNCGK-------SSVFSP-APWLVKIRPELSSNITCTGTLINER 60
            :||.||..     ..::.||:..||.       :.:..| |.||..|  ...:::.|:|:||:::
  Fly     4 LFAWLLMLTVLQSHVNSKFLDDYCGAPISNQSITKLRQPQAGWLAHI--SNGTHVLCSGSLISKQ 66

  Fly    61 FVLTAASCIDYQTELIVRLGEIDGTLQNSSKLQYEEIYVARALIHRSYSSESHQYNIALLRLKTS 125
            |||:||.|||...:|.|:||     :.|::|..:  .|....::..|:|.:..|.:|.||:|..|
  Fly    67 FVLSAAQCIDVHGKLFVQLG-----VSNATKSPH--WYTVSNVVIPSHSGKRLQRDIGLLKLSQS 124

  Fly   126 VVYKKNIQPICIDVNVGKVPKAPTFE-------IEKKKNEE---------------------PKK 162
            |.|...:.||||.:|...:......:       :.|.||.:                     ||:
  Fly   125 VDYNDFVYPICIALNTNTLDMVKILQNFTTSAWLSKNKNPQTIVLSQLSRDRCKLNLSGNVTPKE 189

  Fly   163 NKAGIMKRFLNWFLSLFGVREPRPDVILPPQPIAVGWPLTKQINESALFHQYGILSHRNSESKKD 227
            ..|..::|..:.|:......         .|||..|..:.:::    ||...|.::.|:..|:..
  Fly   190 ICAASLQRNNSCFIDSGSAL---------TQPIIQGSNIVREM----LFGIRGYVNGRSWCSEPA 241

  Fly   228 VYTDVMAYVNWI 239
            :|.||...|.||
  Fly   242 IYIDVAECVGWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:304450 34/99 (34%)
CG42694NP_001188994.1 Tryp_SPc 46..256 CDD:304450 60/230 (26%)
Tryp_SPc 46..253 CDD:214473 58/228 (25%)
Tryp_SPc 319..505 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463245
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.