DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43294 and LOC4576210

DIOPT Version :10

Sequence 1:NP_001356903.1 Gene:CG43294 / 12798218 FlyBaseID:FBgn0262986 Length:143 Species:Drosophila melanogaster
Sequence 2:XP_001237816.2 Gene:LOC4576210 / 4576210 VectorBaseID:AGAMI1_010698 Length:373 Species:Anopheles gambiae


Alignment Length:67 Identity:22/67 - (32%)
Similarity:28/67 - (41%) Gaps:8/67 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 WPFPNDCHRYYE-----TRLLDCPPEFYWNSQLLQCN--SQTPVGCSSIDPITN-WNNSYPNSPP 83
            |....||.|||.     .:...||...|||.|..:|:  |.:..||..|.|..| |.:....:|.
Mosquito   300 WAHGTDCSRYYGCLEGCVKEFKCPDGLYWNDQQKRCDSYSSSQCGCPDIPPAPNMWPSMTSQTPS 364

  Fly    84 IK 85
            .|
Mosquito   365 AK 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43294NP_001356903.1 ChtBD2 96..139 CDD:214696
LOC4576210XP_001237816.2 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.