DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43229 and LOC5667518

DIOPT Version :10

Sequence 1:NP_001245738.1 Gene:CG43229 / 12798152 FlyBaseID:FBgn0262874 Length:82 Species:Drosophila melanogaster
Sequence 2:XP_001688387.2 Gene:LOC5667518 / 5667518 VectorBaseID:AGAMI1_014069 Length:125 Species:Anopheles gambiae


Alignment Length:55 Identity:16/55 - (29%)
Similarity:25/55 - (45%) Gaps:12/55 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CGP-YECRLSNPICRCESFCQEFSQRCWKNPSGCHCARGYARN-ERGHCVPLILC 81
            ||| |:......:..|       :.||:   :.|:||.|:.|. ..|.|:|.:.|
Mosquito    64 CGPCYQLNCYGTVLDC-------AGRCY---AECYCASGFVREYPGGRCIPKLFC 108

Return to query results.
Submit another query.