DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43229 and Y69H2.10

DIOPT Version :10

Sequence 1:NP_001245738.1 Gene:CG43229 / 12798152 FlyBaseID:FBgn0262874 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_001024279.1 Gene:Y69H2.10 / 190560 WormBaseID:WBGene00013485 Length:572 Species:Caenorhabditis elegans


Alignment Length:47 Identity:19/47 - (40%)
Similarity:23/47 - (48%) Gaps:6/47 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 CR--CESFCQEFSQRCWKN---PSGCHCARGYARNERGHCVPLILCP 82
            |:  ||..|:|.|..|..:   .|||.|.|||.| ..|.|..:..||
 Worm   394 CKSGCEGTCEEPSPPCMNSTTCTSGCACIRGYVR-INGVCELMSKCP 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43229NP_001245738.1 None
Y69H2.10NP_001024279.1 TIL 386..438 CDD:410995 17/44 (39%)
TIL 448..514 CDD:460351
TIL 520..571 CDD:460351
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.