DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43229 and spi-3

DIOPT Version :10

Sequence 1:NP_001245738.1 Gene:CG43229 / 12798152 FlyBaseID:FBgn0262874 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_505344.2 Gene:spi-3 / 182891 WormBaseID:WBGene00016096 Length:157 Species:Caenorhabditis elegans


Alignment Length:55 Identity:19/55 - (34%)
Similarity:26/55 - (47%) Gaps:10/55 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 SCGPYECRLSNPICRCE-SFCQEFSQRCWKNPSGCHCARGYARNERGHCVPLILC 81
            :|| |:|   .|.|..: :.|   |..|  .|:.|.|..||.||.:..||..:.|
 Worm    38 ACG-YDC---EPQCGFDPTVC---SLEC--KPNACVCKDGYVRNTKNDCVRRLEC 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43229NP_001245738.1 None
spi-3NP_505344.2 TIL 30..83 CDD:460351 18/53 (34%)
TIL 90..144 CDD:460351
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.