DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1Lcsd and cbx3b

DIOPT Version :10

Sequence 1:NP_001246478.1 Gene:HP1Lcsd / 12798145 FlyBaseID:FBgn0263084 Length:83 Species:Drosophila melanogaster
Sequence 2:NP_001373276.1 Gene:cbx3b / 567497 ZFINID:ZDB-GENE-070628-2 Length:194 Species:Danio rerio


Alignment Length:37 Identity:19/37 - (51%)
Similarity:28/37 - (75%) Gaps:0/37 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 MFLIKFKDSPVVEVVPGIEANRRIPQMVIEFYMDHLS 63
            |||||:|::..|.::..:||::|.|||||.||.|.|:
Zfish   151 MFLIKWKNTDEVALLAAVEASKRWPQMVIRFYEDKLT 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1LcsdNP_001246478.1 CSD 10..62 CDD:349275 18/34 (53%)
cbx3bNP_001373276.1 CD_CSD 20..68 CDD:475127
Chromo_shadow 137..188 CDD:460191 19/37 (51%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.