DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment HP1Lcsd and HP1c

DIOPT Version :9

Sequence 1:	NP_001246478.1	Gene:	HP1Lcsd / 12798145	FlyBaseID:	FBgn0263084	Length:	83	Species:	Drosophila melanogaster
Sequence 2:	NP_651093.1	Gene:	HP1c / 42696	FlyBaseID:	FBgn0039019	Length:	237	Species:	Drosophila melanogaster

Alignment Length:	77	Identity:	17/77 - (22%)
Similarity:	37/77 - (48%)	Gaps:	11/77 - (14%)

- Green bases have known domain annotations that are detailed below.

  Fly     6 FVRGRMVEKIVYVFTTANKNTMFLIKFKDSPVVEVVPGIEANRRIPQMVIEF------YMDHLSL 64
            :.||..:.:||.. |....:..:|::::.....::||..:...:.|||:|::      |..|:::
  Fly    81 YERGLELAEIVGA-TDVTGDIKYLVRWQFCDEFDLVPSAQIVEKDPQMLIDYFQKMAPYSRHIAM 144

  Fly    65 PPPESRKGNPRK 76
                ..||.|.:
  Fly   145 ----RMKGVPEE 152

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
HP1Lcsd	NP_001246478.1	Chromo_shadow	12..63	CDD:279701	12/56 (21%)
HP1c	NP_651093.1	Chromo	9..58	CDD:278797
HP1c	NP_651093.1	Chromo_shadow	89..134	CDD:279701	10/45 (22%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0000191
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	2	1.910