DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1Lcsd and HP1c

DIOPT Version :10

Sequence 1:NP_001246478.1 Gene:HP1Lcsd / 12798145 FlyBaseID:FBgn0263084 Length:83 Species:Drosophila melanogaster
Sequence 2:NP_651093.1 Gene:HP1c / 42696 FlyBaseID:FBgn0039019 Length:237 Species:Drosophila melanogaster


Alignment Length:77 Identity:17/77 - (22%)
Similarity:37/77 - (48%) Gaps:11/77 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FVRGRMVEKIVYVFTTANKNTMFLIKFKDSPVVEVVPGIEANRRIPQMVIEF------YMDHLSL 64
            :.||..:.:||.. |....:..:|::::.....::||..:...:.|||:|::      |..|:::
  Fly    81 YERGLELAEIVGA-TDVTGDIKYLVRWQFCDEFDLVPSAQIVEKDPQMLIDYFQKMAPYSRHIAM 144

  Fly    65 PPPESRKGNPRK 76
                ..||.|.:
  Fly   145 ----RMKGVPEE 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1LcsdNP_001246478.1 CSD 10..62 CDD:349275 11/57 (19%)
HP1cNP_651093.1 CD_CSD 8..55 CDD:475127
CSD 85..135 CDD:349275 10/50 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.