powered by:
Protein Alignment HP1Lcsd and cbx1b
DIOPT Version :9
Sequence 1: | NP_001246478.1 |
Gene: | HP1Lcsd / 12798145 |
FlyBaseID: | FBgn0263084 |
Length: | 83 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001002090.1 |
Gene: | cbx1b / 415180 |
ZFINID: | ZDB-GENE-040625-68 |
Length: | 203 |
Species: | Danio rerio |
Alignment Length: | 69 |
Identity: | 28/69 - (40%) |
Similarity: | 40/69 - (57%) |
Gaps: | 4/69 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 FVRGRMVEKIVYVFTTANKNTMFLIKFKDSPVVEVVPGIEANRRIPQMVIEFYMDHL---SLPPP 67
|.||...|:|:.. |.::...|||:|:|:|...::||..|||.:.||:||.||.:.| |.|..
Zfish 131 FARGLDPERIIGA-TDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPTE 194
Fly 68 ESRK 71
|..|
Zfish 195 EEEK 198
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000191 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.