powered by:
Protein Alignment HP1Lcsd and Su(var)205
DIOPT Version :9
Sequence 1: | NP_001246478.1 |
Gene: | HP1Lcsd / 12798145 |
FlyBaseID: | FBgn0263084 |
Length: | 83 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_476755.1 |
Gene: | Su(var)205 / 34119 |
FlyBaseID: | FBgn0003607 |
Length: | 206 |
Species: | Drosophila melanogaster |
Alignment Length: | 60 |
Identity: | 27/60 - (45%) |
Similarity: | 34/60 - (56%) |
Gaps: | 1/60 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 TPFVRGRMVEKIVYVFTTANKNTMFLIKFKDSPVVEVVPGIEANRRIPQMVIEFYMDHLS 63
|.|.||...|||:.. :..|....|||:||.....|:||...||.:||:|||.||.:.||
Fly 141 TGFDRGLEAEKILGA-SDNNGRLTFLIQFKGVDQAEMVPSSVANEKIPRMVIHFYEERLS 199
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
HP1Lcsd | NP_001246478.1 |
Chromo_shadow |
12..63 |
CDD:279701 |
21/50 (42%) |
Su(var)205 | NP_476755.1 |
CHROMO |
24..72 |
CDD:237991 |
|
ChSh |
141..202 |
CDD:197638 |
27/60 (45%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000191 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.