DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment HP1Lcsd and HP1b

DIOPT Version :9

Sequence 1:	NP_001246478.1	Gene:	HP1Lcsd / 12798145	FlyBaseID:	FBgn0263084	Length:	83	Species:	Drosophila melanogaster
Sequence 2:	NP_001162713.1	Gene:	HP1b / 31834	FlyBaseID:	FBgn0030082	Length:	240	Species:	Drosophila melanogaster

Alignment Length:	58	Identity:	24/58 - (41%)
Similarity:	36/58 - (62%)	Gaps:	1/58 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly     6 FVRGRMVEKIVYVFTTANKNTMFLIKFKDSPVVEVVPGIEANRRIPQMVIEFYMDHLS 63
            |.||....||:.. |.::.:.|||:|:|.|...::||...||.|.||:||:||.:.|:
  Fly    95 FERGLEASKILGA-TDSSGHLMFLMKWKGSDHADLVPAKLANTRCPQVVIQFYEERLT 151

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
HP1Lcsd	NP_001246478.1	Chromo_shadow	12..63	CDD:279701	20/50 (40%)
HP1b	NP_001162713.1	CHROMO	3..52	CDD:214605
HP1b	NP_001162713.1	Chromo_shadow	100..151	CDD:279701	20/51 (39%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0000191
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	2	1.910