powered by:
Protein Alignment HP1Lcsd and chp2
DIOPT Version :9
Sequence 1: | NP_001246478.1 |
Gene: | HP1Lcsd / 12798145 |
FlyBaseID: | FBgn0263084 |
Length: | 83 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_596808.1 |
Gene: | chp2 / 2540047 |
PomBaseID: | SPBC16C6.10 |
Length: | 380 |
Species: | Schizosaccharomyces pombe |
Alignment Length: | 52 |
Identity: | 13/52 - (25%) |
Similarity: | 25/52 - (48%) |
Gaps: | 1/52 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 11 MVEKIVYVFTTANKNTMFLIKFKDSPVVEVVPGIEANRRIPQMVIEFYMDHL 62
:|:.:..|....|...:..||:|:. .|.....|..:::.|..:||:|..|:
pombe 327 LVDCVKTVQQLDNGKLIAKIKWKNG-YVSTHDNIIIHQKCPLKIIEYYEAHI 377
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.