DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1Lcsd and chp2

DIOPT Version :9

Sequence 1:NP_001246478.1 Gene:HP1Lcsd / 12798145 FlyBaseID:FBgn0263084 Length:83 Species:Drosophila melanogaster
Sequence 2:NP_596808.1 Gene:chp2 / 2540047 PomBaseID:SPBC16C6.10 Length:380 Species:Schizosaccharomyces pombe


Alignment Length:52 Identity:13/52 - (25%)
Similarity:25/52 - (48%) Gaps:1/52 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 MVEKIVYVFTTANKNTMFLIKFKDSPVVEVVPGIEANRRIPQMVIEFYMDHL 62
            :|:.:..|....|...:..||:|:. .|.....|..:::.|..:||:|..|:
pombe   327 LVDCVKTVQQLDNGKLIAKIKWKNG-YVSTHDNIIIHQKCPLKIIEYYEAHI 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1LcsdNP_001246478.1 Chromo_shadow 12..63 CDD:279701 13/51 (25%)
chp2NP_596808.1 CHROMO 174..228 CDD:237991
ChSh 316..380 CDD:197638 13/52 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.