DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1Lcsd and hpl-2

DIOPT Version :10

Sequence 1:NP_001246478.1 Gene:HP1Lcsd / 12798145 FlyBaseID:FBgn0263084 Length:83 Species:Drosophila melanogaster
Sequence 2:NP_001022654.1 Gene:hpl-2 / 176506 WormBaseID:WBGene00001996 Length:303 Species:Caenorhabditis elegans


Alignment Length:72 Identity:20/72 - (27%)
Similarity:33/72 - (45%) Gaps:1/72 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 MVEKIVYVFTTANKNTMFLIKFKDSPVVEVVPGIEANRRIPQMVIEFYMDHLSLPPPESRKGNPR 75
            ||||::...|.......|||:::..|..:.......|.:..:|:.||..:......| .||.:.:
 Worm    20 MVEKVLDKRTGKAGRDEFLIQWQGFPESDSSWEPRENLQCVEMLDEFEREFSKREKP-IRKRHSQ 83

  Fly    76 KRKASED 82
            |.:.|||
 Worm    84 KPEPSED 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1LcsdNP_001246478.1 CSD 10..62 CDD:349275 13/50 (26%)
hpl-2NP_001022654.1 CD_HP1_like 18..68 CDD:349316 13/47 (28%)
CD_CSD 109..>153 CDD:475127
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.