DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1Lcsd and hpl-2

DIOPT Version :9

Sequence 1:NP_001246478.1 Gene:HP1Lcsd / 12798145 FlyBaseID:FBgn0263084 Length:83 Species:Drosophila melanogaster
Sequence 2:NP_001022654.1 Gene:hpl-2 / 176506 WormBaseID:WBGene00001996 Length:303 Species:Caenorhabditis elegans


Alignment Length:72 Identity:20/72 - (27%)
Similarity:33/72 - (45%) Gaps:1/72 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 MVEKIVYVFTTANKNTMFLIKFKDSPVVEVVPGIEANRRIPQMVIEFYMDHLSLPPPESRKGNPR 75
            ||||::...|.......|||:::..|..:.......|.:..:|:.||..:......| .||.:.:
 Worm    20 MVEKVLDKRTGKAGRDEFLIQWQGFPESDSSWEPRENLQCVEMLDEFEREFSKREKP-IRKRHSQ 83

  Fly    76 KRKASED 82
            |.:.|||
 Worm    84 KPEPSED 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1LcsdNP_001246478.1 Chromo_shadow 12..63 CDD:279701 12/50 (24%)
hpl-2NP_001022654.1 CD_HP1_like 18..68 CDD:349316 13/47 (28%)
CD_CSD 109..>153 CDD:391946
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.