DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43326 and cdip1

DIOPT Version :10

Sequence 1:NP_001246463.1 Gene:CG43326 / 12798140 FlyBaseID:FBgn0263031 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_001092712.1 Gene:cdip1 / 557073 ZFINID:ZDB-GENE-070720-18 Length:213 Species:Danio rerio


Alignment Length:98 Identity:28/98 - (28%)
Similarity:35/98 - (35%) Gaps:21/98 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 SAATTVTLEERPSKPQVRFFSIGPSSYQVRCPLCQQNSKTETVEMTGALGQLSCLL-----STLS 83
            :|.||||:      .|...|...|  .|..||.|||...|......|.:..|.|:.     ..|.
Zfish   125 AATTTVTV------LQGEMFQSAP--VQTVCPHCQQPIITRISHDIGLMNTLVCMFCFFVGCDLG 181

  Fly    84 CCFPIFALTFVYSCLQSRLKSKRVFCSRCGGHL 116
            ||        :..||...||.....|..|.|::
Zfish   182 CC--------LIPCLIDDLKDVTHTCPNCKGYI 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43326NP_001246463.1 LITAF 49..121 CDD:197841 20/73 (27%)
cdip1NP_001092712.1 zf-LITAF-like 142..210 CDD:463165 21/75 (28%)

Return to query results.
Submit another query.