DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43326 and CG3746

DIOPT Version :10

Sequence 1:NP_001246463.1 Gene:CG43326 / 12798140 FlyBaseID:FBgn0263031 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_611697.1 Gene:CG3746 / 37593 FlyBaseID:FBgn0034755 Length:151 Species:Drosophila melanogaster


Alignment Length:97 Identity:36/97 - (37%)
Similarity:57/97 - (58%) Gaps:6/97 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 QSAATTVTLEERPSKPQVRFFSIGPSSYQVRCPLCQQNSKTETVEMTGALGQLSCLLSTLSCCFP 87
            ||||.....::.||   :|::::|||:|::.||||::.|:...:..........| ||.|||.||
  Fly    53 QSAAPLSAAQQEPS---IRYYAVGPSTYKLLCPLCRERSEAAVMRAASCKDASFC-LSLLSCIFP 113

  Fly    88 IFALTFVYS-CLQSR-LKSKRVFCSRCGGHLG 117
            :|.:..|.: |..:| ..:|.|:||.|||.:|
  Fly   114 LFWICCVCTWCGCNREWTTKGVYCSSCGGKVG 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43326NP_001246463.1 LITAF 49..121 CDD:197841 26/71 (37%)
CG3746NP_611697.1 None

Return to query results.
Submit another query.