DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43326 and Cdip1

DIOPT Version :10

Sequence 1:NP_001246463.1 Gene:CG43326 / 12798140 FlyBaseID:FBgn0263031 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_001008361.1 Gene:Cdip1 / 360480 RGDID:1310686 Length:208 Species:Rattus norvegicus


Alignment Length:97 Identity:29/97 - (29%)
Similarity:35/97 - (36%) Gaps:21/97 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 AATTVTLEERPSKPQVRFFSIGPSSYQVRCPLCQQNSKT----ETVEMTGALGQLSCLLS-TLSC 84
            ||||||:      .|...|...|  .|..||.|||...|    |...|...||...|.:. .|.|
  Rat   121 AATTVTV------LQGEIFEGAP--VQTVCPHCQQAITTKISYEIGLMNFVLGFFCCFMGCDLGC 177

  Fly    85 CFPIFALTFVYSCLQSRLKSKRVFCSRCGGHL 116
            |        :..||.:..|.....|..|..::
  Rat   178 C--------LIPCLINDFKDVTHTCPSCKAYI 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43326NP_001246463.1 LITAF 49..121 CDD:197841 20/73 (27%)
Cdip1NP_001008361.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..70
zf-LITAF-like 137..205 CDD:463165 21/75 (28%)
Membrane-binding amphipathic helix. /evidence=ECO:0000305 164..184 7/27 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.