DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43326 and F16F9.1

DIOPT Version :10

Sequence 1:NP_001246463.1 Gene:CG43326 / 12798140 FlyBaseID:FBgn0263031 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_509434.2 Gene:F16F9.1 / 184573 WormBaseID:WBGene00017513 Length:157 Species:Caenorhabditis elegans


Alignment Length:41 Identity:11/41 - (26%)
Similarity:18/41 - (43%) Gaps:7/41 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 PAS-------QHSLAQCWAQLIAKVQEIQIMFQCSIESKRP 140
            |||       :..||.|...|....:|::|..:...|.::|
 Worm   132 PASSVSDGSPEQDLAMCLMMLSRDSRELEIKLKKPEEERKP 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43326NP_001246463.1 LITAF 49..121 CDD:197841 6/20 (30%)
F16F9.1NP_509434.2 zf-LITAF-like 88..154 CDD:463165 7/21 (33%)

Return to query results.
Submit another query.