DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43393 and CG42393

DIOPT Version :10

Sequence 1:NP_001246456.1 Gene:CG43393 / 12798138 FlyBaseID:FBgn0263250 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_001137967.1 Gene:CG42393 / 7354474 FlyBaseID:FBgn0259739 Length:135 Species:Drosophila melanogaster


Alignment Length:140 Identity:45/140 - (32%)
Similarity:63/140 - (45%) Gaps:20/140 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MCMVTSVSP-EVCTSFYATWCLVWGSLFGFGYSF---LLLADLMEVVTV----------DRNFPF 51
            ||......| ..|:.|||.:|:..| ||...:|.   :||...:.||..          ...|..
  Fly     1 MCKSCEEQPVRCCSIFYAAFCISCG-LFMLIFSIHNVILLKSSITVVDFYLHMHGADMSPSTFRI 64

  Fly    52 QRTLRVVIAGLGLSYLGAGILMTLGIKYNKPIVFKCGKFLCLIFAIGSIPTIIFP-VVHFCTIPC 115
            ..::.|:.|   |||:.||.|:.:||..|...||..||.:...|.|.:| ..:|| :||......
  Fly    65 LYSMDVIFA---LSYVIAGTLLAVGIHLNSKGVFFAGKIISYFFPIYNI-LYVFPLIVHIAATVK 125

  Fly   116 LCRYMKNRWN 125
            ||||:|..:|
  Fly   126 LCRYLKENFN 135

Return to query results.
Submit another query.