DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43090 and CG43074

DIOPT Version :9

Sequence 1:NP_001245546.1 Gene:CG43090 / 12798122 FlyBaseID:FBgn0262536 Length:169 Species:Drosophila melanogaster
Sequence 2:NP_001246604.1 Gene:CG43074 / 12798579 FlyBaseID:FBgn0262484 Length:182 Species:Drosophila melanogaster


Alignment Length:170 Identity:52/170 - (30%)
Similarity:82/170 - (48%) Gaps:26/170 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTWIWTLLLLGLV----------------TAQGPSEEIAE---------IDAEVTKKLKSFLENF 40
            |.|||:|:.||:|                |...||....|         :|..:|..|::.|..:
  Fly     1 MVWIWSLIALGIVVGATGENGSKPNTTEPTTTAPSSRTPETTTVSPYTALDKTITDDLQNILTTY 65

  Fly    41 TGYWKDNTEFLNWIAKIRLALNNNSTDLAYKFELRYGFESYNKERLVLEQQILDRVEDLDSIIPH 105
            ......|:||...:..||:|:..:...|..|.|.|..|:.||::|:::|:||.:|:|.|::|:|.
  Fly    66 ERECIGNSEFTRNLDLIRIAVKWDQGRLREKIEARRDFDVYNEQRILIERQIDERIEALNNILPT 130

  Fly   106 QK-HAKCLNFYVDQRNALKTALKQSNSKKIERFAENSPSC 144
            |: ::.|..||:.||.||:.|...||..|......|...|
  Fly   131 QEPNSYCSEFYLKQREALRNAKSLSNQDKSNTLIINKAIC 170



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449843
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008555
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.