DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43136 and CG43115

DIOPT Version :9

Sequence 1:NP_001245538.1 Gene:CG43136 / 12798119 FlyBaseID:FBgn0262610 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001245542.1 Gene:CG43115 / 12798121 FlyBaseID:FBgn0262575 Length:184 Species:Drosophila melanogaster


Alignment Length:188 Identity:149/188 - (79%)
Similarity:156/188 - (82%) Gaps:20/188 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTNLICVSLAGLLHVIQFLAFYSRSANTPAPKLPSLFVGLAAMDIIWNNCFVPRALQNRTAVIRW 65
            |||||||||||||||||||||||||||||||||||||||||||||||:||||||.||.|:|||||
  Fly     1 MTNLICVSLAGLLHVIQFLAFYSRSANTPAPKLPSLFVGLAAMDIIWDNCFVPRKLQKRSAVIRW 65

  Fly    66 IYELIVSYLLLEFVQMFWKPVDNICVVLMRLIILGTGIVSETNYENYESYWVGFLTVPLSLLILA 130
            |||||||:|||..||:||||||||||:||||||||||||||||||||||||||||||||||||||
  Fly    66 IYELIVSHLLLGLVQVFWKPVDNICVILMRLIILGTGIVSETNYENYESYWVGFLTVPLSLLILA 130

  Fly   131 IASQATDLFPVLRGYKMQNVVIVQLQWKGALRYINRNPTKRLRRIVPILREHRDQARR 188
            ||.||||.|.|||.||||||        |||:|    |||||        .||..:.|
  Fly   131 IAGQATDHFSVLRAYKMQNV--------GALKY----PTKRL--------PHRSDSER 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43136NP_001245538.1 DUF4818 31..140 CDD:292707 97/108 (90%)
CG43115NP_001245542.1 DUF4818 31..139 CDD:292707 97/107 (91%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460591
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2D91D
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0019348
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.