DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43288 and Bsn

DIOPT Version :10

Sequence 1:NP_001245522.1 Gene:CG43288 / 12798106 FlyBaseID:FBgn0262980 Length:60 Species:Drosophila melanogaster
Sequence 2:NP_062019.2 Gene:Bsn / 29138 RGDID:2223 Length:3933 Species:Rattus norvegicus


Alignment Length:53 Identity:20/53 - (37%)
Similarity:30/53 - (56%) Gaps:1/53 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IIPEKFDFEEEIARLMVEYDLIAIADRDESESEDSEFDDDSDSQIFSTYEEDS 60
            |:||.||.:||:..::.|.|.:|.. |...:.:.:|..||..||:...|.|||
  Rat   764 IMPEAFDSDEELGDILEEDDSLAWG-RQREQQDTAESSDDFGSQLRHDYVEDS 815

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43288NP_001245522.1 None
BsnNP_062019.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..158
4 X 2 AA tandem repeats of P-G 62..70
FYVE1_BSN 162..225 CDD:277312
PRK12323 <193..>346 CDD:481241
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 228..346
PHA03247 <246..676 CDD:223021
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 361..456
FYVE_like_SF 459..523 CDD:333710
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 523..921 20/53 (38%)
3 X 7 AA tandem repeats of K-A-S-P-Q-A-[AK] 568..588
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1293..1540
PHA03247 <1333..1651 CDD:223021
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1560..1610
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1913..1963
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 2279..2304
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 2317..2342
DUF4659 <2350..>2420 CDD:464768
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 2460..2485
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 2512..2647
Interaction with DAO. /evidence=ECO:0000269|PubMed:21700703 2714..3262
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 2838..2858
Sufficient for binding to ERC2 2933..2995
PHA03307 3038..>3396 CDD:223039
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 3054..3147
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 3161..3398
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 3413..3545
PHA03247 <3476..3889 CDD:223021
PRK07764 <3731..3915 CDD:236090
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.