DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43618 and CG42869

DIOPT Version :10

Sequence 1:NP_001246981.1 Gene:CG43618 / 12798057 FlyBaseID:FBgn0263596 Length:56 Species:Drosophila melanogaster
Sequence 2:NP_001189264.2 Gene:CG42869 / 10178817 FlyBaseID:FBgn0262143 Length:66 Species:Drosophila melanogaster


Alignment Length:58 Identity:47/58 - (81%)
Similarity:53/58 - (91%) Gaps:3/58 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 IISILGFVVG---LESTSSSTTTTSMRSAPYCQPSGGYCRMHVDCCSRMCIQVSAECR 56
            ::||||.|||   |:||||.|||::|||||||||||||||||:|||||||||||||||
  Fly     9 LVSILGIVVGFQKLDSTSSPTTTSTMRSAPYCQPSGGYCRMHMDCCSRMCIQVSAECR 66

Return to query results.
Submit another query.